| Edit |   |
| Antigenic Specificity | SDK1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SDK1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SDK1. This antibody reacts with human. The SDK1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human SDK1. Peptide sequence AVNEAGYGEPSNPSTAVSAQVEAPFYEEWWFLLVMALSSLIVILLVVFAL. |
| Other Names | protein sidekick-1, sidekick homolog 1, cell adhesion molecule (chicken) |
| Gene, Accession # | SDK1, Gene ID: 221935, Accession: NP_001073121, SwissProt: NP_001073121 |
| Catalog # | NBP1-91593 |
| Price | |
| Order / More Info | SDK1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |