| 产品详情 |
| Edit |   |
| Antigenic Specificity | PDGF R beta |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. IHC, WB reported in scientific literature (PMID: 23441134). |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PDGF R beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDGF R beta. This antibody reacts with human. The PDGF R beta Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. Specificity of human PDGFR beta/PDGFRB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVAL |
| Other Names | beta-type platelet-derived growth factor receptor, CD140 antigen-like family member B, CD140b, CD140b antigen, EC 2.7.10, EC 2.7.10.1, JTK12, PDGFR, PDGFR1, PDGF-R-beta, platelet-derived growth factor receptor, beta polypeptide |
| Gene, Accession # | PDGFRB, Gene ID: 5159 |
| Catalog # | NBP1-88134 |
| Price | |
| Order / More Info | PDGF R beta Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23441134 |
| 产品资料 |
|
|