| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TSTA3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TSTA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSTA3. This antibody reacts with human. The TSTA3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TSTA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVG |
|---|
| Other Names | EC 1.1.1.271, FX, GDP-4-keto-6-deoxy-D-mannose epimerase-reductase, GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase, GDP-L-fucose synthase, P35B, Protein FX, Red cell NADP(H)-binding protein, SDR4E13-5 epimerase/4-reductase, short chain dehydrogenase/reductase family 4E, member 1, Short-chain dehydrogenase/reductase family 4E member 1, tissue specific transplantation antigen 3, tissue specific transplantation antigen P35B, Tissue-specific transplantation antigen-3 |
|---|
| Gene, Accession # | TSTA3, Gene ID: 7264 |
|---|
| Catalog # | NBP1-83408 |
|---|
| Price | |
|---|
| Order / More Info | TSTA3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|