| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SUR1 and SUR2B |
|---|
| Clone | S323A-31 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | rat |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein G purified |
|---|
| Size | 100 ug |
|---|
| Concentration | n/a |
|---|
| Applications | ICC, IF, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Mouse monoclonal to SUR1 and SUR2B.Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea classof antidiabetic drugs whose mechanism of action is topromote insulin release from pancreatic beta cells. Morespecifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2).The association of four Kir6.x and four SUR subunits forman ion conducting channel commonly referred to as theKATP channel.The primary function of the sulfonylurea receptor is to senseintracellular levels of the nucleotides ATP and ADP and inresponse facilitate the open or closing its associated Kir6.xpotassium channel. Hence the KATPchannel monitors the energy balance within the cell. |
|---|
| Immunogen | Fusion protein amino acids 1503-1545([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B, accessionnumber Q63563-2. |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | orb99101 |
|---|
| Price | |
|---|
| Order / More Info | SUR1 and SUR2B Antibody from BIORBYT LTD. |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|