| Edit |   |
|---|
| Antigenic Specificity | Leucine-Rich alpha-2 Glycoprotein 1 (LRG1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation. |
|---|
| Immunogen | LRG1 antibody was raised using the N terminal of LRG1 corresponding to a region with amino acids GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP |
|---|
| Other Names | lrg|HMFT1766|LRG|1300008B03Rik|2310031E04Rik|Lrg|Lrhg |
|---|
| Gene, Accession # | Gene ID: 116844 |
|---|
| Catalog # | ABIN633085 |
|---|
| Price | |
|---|
| Order / More Info | Leucine-Rich alpha-2 Glycoprotein 1 (LRG1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|