| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kallikrein 4/Prostase/EMSP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kallikrein 4/Prostase/EMSP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kallikrein 4/Prostase/EMSP1. This antibody reacts with human. The Kallikrein 4/Prostase/EMSP1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Kallikrein 4/Prostase/EMSP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TIRSISIASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSK LYDPLYH |
|---|
| Other Names | AI2A1, ARM1, EC 3.4.21, EC 3.4.21.-, EMSP, EMSP1MGC116827, Enamel matrix serine proteinase 1, kallikrein 4 (prostase, enamel matrix, prostate), kallikrein-4, Kallikrein-like protein 1, kallikrein-related peptidase 4, KLK-L1MGC116828, Prostase, PRSS17enamel matrix serine protease 1, PSTSandrogen-regulated message 1, Serine protease 17 |
|---|
| Gene, Accession # | KLK4, Gene ID: 9622 |
|---|
| Catalog # | NBP2-14171 |
|---|
| Price | |
|---|
| Order / More Info | Kallikrein 4/Prostase/EMSP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|