| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kallikrein 4/Prostase/EMSP1 |
|---|
| Clone | 2A4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kallikrein 4/Prostase/EMSP1 Antibody (2A4) from Novus Biologicals is a mouse monoclonal antibody to Kallikrein 4/Prostase/EMSP1. This antibody reacts with human. The Kallikrein 4/Prostase/EMSP1 Antibody (2A4) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | KLK4 (NP_004908, 159 a.a. 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26. GRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCAGGGQDQKDSCNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQAS |
|---|
| Other Names | AI2A1, ARM1, EC 3.4.21, EC 3.4.21.-, EMSP, EMSP1MGC116827, Enamel matrix serine proteinase 1, kallikrein 4 (prostase, enamel matrix, prostate), kallikrein-4, Kallikrein-like protein 1, kallikrein-related peptidase 4, KLK-L1MGC116828, Prostase, PRSS17enamel matrix serine protease 1, PSTSandrogen-regulated message 1, Serine protease 17 |
|---|
| Gene, Accession # | KLK4, Gene ID: 9622, Accession: NP_004908, SwissProt: NP_004908 |
|---|
| Catalog # | H00009622-M09 |
|---|
| Price | |
|---|
| Order / More Info | Kallikrein 4/Prostase/EMSP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|