| Edit |   |
|---|
| Antigenic Specificity | Glucosidase, Alpha, Neutral C (GANC) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GANC has alpha-glucosidase activity.Glycosyl hydrolase enzymes hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. |
|---|
| Immunogen | GANC antibody was raised using the middle region of GANC corresponding to a region with amino acids VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR |
|---|
| Other Names | 5830445O15Rik|9330160A12|mFLJ00088 |
|---|
| Gene, Accession # | Gene ID: 2595 |
|---|
| Catalog # | ABIN632846 |
|---|
| Price | |
|---|
| Order / More Info | Glucosidase, Alpha, Neutral C (GANC) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|