| Edit |   |
|---|
| Antigenic Specificity | Glucuronidase, beta (GUSB) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GUSB plays an important role in the degradation of dermatan and keratan sulfates. |
|---|
| Immunogen | GUSB antibody was raised using the C terminal of GUSB corresponding to a region with amino acids VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF |
|---|
| Other Names | GUSB|beta-GUS|gus|BG|MPS7|AI747421|Gur|Gus|Gus-r|Gus-s|Gus-t|Gus-u|Gut|asd|g|Ac2-223|si:ch211-160e1.7|si:ct573103.7 |
|---|
| Gene, Accession # | Gene ID: 2990 |
|---|
| Catalog # | ABIN630431 |
|---|
| Price | |
|---|
| Order / More Info | Glucuronidase, beta (GUSB) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|