| Edit |   |
| Antigenic Specificity | STYK1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The STYK1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to STYK1. This antibody reacts with human. The STYK1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to STYK1(serine/threonine/tyrosine kinase 1) The peptide sequence was selected from the C terminal of STYK1. Peptide sequence PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKI. |
| Other Names | DKFZp761P1010, EC 2.7.10.2, NOKProtein PK-unique, serine/threonine/tyrosine kinase 1Novel oncogene with kinase domain, SuRTK106, tyrosine-protein kinase STYK1 |
| Gene, Accession # | STYK1, Gene ID: 55359, Accession: Q6J9G0, SwissProt: Q6J9G0 |
| Catalog # | NBP1-59491-20ul |
| Price | |
| Order / More Info | STYK1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |