| 产品详情 |
| Edit |   |
| Antigenic Specificity | Ndufs1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Ndufs1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ndufs1. This antibody reacts with human. The Ndufs1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Ndufs1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: REDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAV |
| Other Names | CI-75k, CI-75Kd, complex I 75kDa subunit, complex I, mitochondrial respiratory chain, 75-kD subunit, Complex I-75kD, EC 1.6.5.3, EC 1.6.99.3, MGC26839, mitochondrial NADH-ubiquinone oxidoreductase 75 kDa subunit, NADH dehydrogenase (ubiquinone) Fe-S protein 1 (75kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Qreductase), NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial, PRO1304 |
| Gene, Accession # | NDUFS1, Gene ID: 4719 |
| Catalog # | NBP2-56504 |
| Price | |
| Order / More Info | Ndufs1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|