| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDUFS2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDUFS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDUFS2. This antibody reacts with human. The NDUFS2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NDUFS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMP |
|---|
| Other Names | CI-49, CI-49kD, complex 1, mitochondrial respiratory chain, 49-KD subunit, complex I 49kDa subunit, Complex I-49kD, EC 1.6.5.3, EC 1.6.99.3, EC 1.6.99.5, NADH dehydrogenase (ubiquinone) Fe-S protein 2 (49kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Qreductase), NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial, NADH-ubiquinone oxidoreductase 49 kDa subunit, NADH-ubiquinone oxidoreductase NDUFS2 subunit |
|---|
| Gene, Accession # | NDUFS2, Gene ID: 4720 |
|---|
| Catalog # | NBP2-49351 |
|---|
| Price | |
|---|
| Order / More Info | NDUFS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|