| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDUFS5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDUFS5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDUFS5. This antibody reacts with human. The NDUFS5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NDUFS5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGK |
|---|
| Other Names | CI-15 kDa, CI-15k, CI15K, Complex I-15 kDa, NADH dehydrogenase (ubiquinone) Fe-S protein 5 (15kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Qreductase), NADH dehydrogenase [ubiquinone] iron-sulfur protein 5, NADH:ubiquinone oxidoreductase 15 kDa IP subunit, NADH-ubiquinone oxidoreductase 15 kDa subunit |
|---|
| Gene, Accession # | NDUFS5, Gene ID: 4725 |
|---|
| Catalog # | NBP2-13648 |
|---|
| Price | |
|---|
| Order / More Info | NDUFS5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|