| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TIF1 alpha |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TIF1 alpha Antibody from Novus Biologicals is a rabbit polyclonal antibody to TIF1 alpha. This antibody reacts with human. The TIF1 alpha Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TIF1 alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQSPNSSVPSPGLAGPVTMTSVHPPIRSPSA |
|---|
| Other Names | E3 ubiquitin-protein ligase TRIM24, EC 6.3.2, EC 6.3.2.-, hTIF1, PTC6, RING finger protein 82, RNF82Tif1a, TIF1-alpha, TIF1ATIF1ALPHA, TIF1TF1A, transcription intermediary factor 1-alpha, transcriptional intermediary factor 1, tripartite motif containing 24, tripartite motif-containing 24, Tripartite motif-containing protein 24 |
|---|
| Gene, Accession # | TRIM24, Gene ID: 8805 |
|---|
| Catalog # | NBP1-92506 |
|---|
| Price | |
|---|
| Order / More Info | TIF1 alpha Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25278611 |
|---|
| 产品资料 |
|
|