| 产品详情 |
| Edit |   |
| Antigenic Specificity | SLCO1C1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLCO1C1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLCO1C1. This antibody reacts with human. The SLCO1C1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SLCO1C1(solute carrier organic anion transporter family, member 1C1) The peptide sequence was selected from the N terminal of SLCO1C1. Peptide sequence VDTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQ. |
| Other Names | OATP1, OATP14Thyroxine transporter, OATP1C1Solute carrier family 21 member 14, OATPFOAT-RP-5, OATP-FOrganic anion-transporting polypeptide 14, OATPRP5, Organic anion transporter F, Organic anion transporter polypeptide-related protein 5, organic anion transporting polypeptide 14, SLC21A14OATP-14, solute carrier family 21 (organic anion transporter), member 14, solute carrier organic anion transporter family member 1C1, solute carrier organic anion transporter family, member 1C1 |
| Gene, Accession # | SLCO1C1, Gene ID: 53919, Accession: Q9NYB5, SwissProt: Q9NYB5 |
| Catalog # | NBP1-59642 |
| Price | |
| Order / More Info | SLCO1C1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|