| Edit |   |
|---|
| Antigenic Specificity | FNDC8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FNDC8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FNDC8. This antibody reacts with human. The FNDC8 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human FNDC8The immunogen for this antibody is FNDC8. Peptide sequence MASEALHQVGDGEEAVLKKENFNMMNALDQLPKPFSNPKSMNRTVTTKGL. |
|---|
| Other Names | DKFZp434H2215, fibronectin type III domain containing 8, fibronectin type III domain-containing protein 8 |
|---|
| Gene, Accession # | FNDC8, Gene ID: 54752, Accession: NP_060029, SwissProt: NP_060029 |
|---|
| Catalog # | NBP1-79657-20ul |
|---|
| Price | |
|---|
| Order / More Info | FNDC8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|