| Edit |   |
| Antigenic Specificity | FNDC8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FNDC8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FNDC8. This antibody reacts with human. The FNDC8 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human FNDC8The immunogen for this antibody is FNDC8. Peptide sequence MASEALHQVGDGEEAVLKKENFNMMNALDQLPKPFSNPKSMNRTVTTKGL. |
| Other Names | DKFZp434H2215, fibronectin type III domain containing 8, fibronectin type III domain-containing protein 8 |
| Gene, Accession # | FNDC8, Gene ID: 54752, Accession: NP_060029, SwissProt: NP_060029 |
| Catalog # | NBP1-79657 |
| Price | |
| Order / More Info | FNDC8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |