| Edit |   |
|---|
| Antigenic Specificity | HSD17B1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 74%, rat 77%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human HSD17B1 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ALDPSQSFKVYATLRDLKTQGRLWEAARALACPQG |
|---|
| Other Names | hydroxysteroid (17-beta) dehydrogenase 1, EDH17B2, EDHB17, HSD17, MGC138140, SDR28C1 |
|---|
| Gene, Accession # | Gene ID: 3292, UniProt: P14061, ENSG00000108786 |
|---|
| Catalog # | HPA065296 |
|---|
| Price | |
|---|
| Order / More Info | HSD17B1 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|