| 产品详情 |
| Edit |   |
| Antigenic Specificity | HSD11B2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HSD11B2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HSD11B2. This antibody reacts with human. The HSD11B2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HSD11B2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLR |
| Other Names | AME, corticosteroid 11-beta-dehydrogenase isozyme 2,11-beta-HSD2, EC 1.1.1, EC 1.1.1.-, HSD11KAME1, HSD2,11-DH2, hydroxysteroid (11-beta) dehydrogenase 2, NAD-dependent 11-beta-hydroxysteroid dehydrogenase, SDR9C3, short chain dehydrogenase/reductase family 9C member 3,11-beta-hydroxysteroid dehydrogenase type 2 |
| Gene, Accession # | HSD11B2, Gene ID: 3291, Accession: P80365, SwissProt: P80365 |
| Catalog # | NBP2-37898 |
| Price | |
| Order / More Info | HSD11B2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|