| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HSD17B2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HSD17B2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HSD17B2. This antibody reacts with human. The HSD17B2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HSD17B2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVL |
|---|
| Other Names | 17-beta-hydroxysteroid dehydrogenase type 2, 20 alpha-hydroxysteroid dehydrogenase, E2DH, EC 1.1.1.62,17-beta-HSD 2, EC 1.1.1.63, EDH17B220-alpha-HSD, estradiol 17-beta-dehydrogenase 2, HSD17, hydroxysteroid (17-beta) dehydrogenase 2, Microsomal 17-beta-hydroxysteroid dehydrogenase, SDR9C2, short chain dehydrogenase/reductase family 9C, member 2, Testosterone 17-beta-dehydrogenase |
|---|
| Gene, Accession # | HSD17B2, Gene ID: 3294, Accession: P37059, SwissProt: P37059 |
|---|
| Catalog # | NBP1-92011 |
|---|
| Price | |
|---|
| Order / More Info | HSD17B2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25929810 |
|---|
| 产品资料 |
|
|