| Edit |   |
|---|
| Antigenic Specificity | RAB40C, Member RAS Oncogene Family (RAB40C) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RAB40C is a probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. |
|---|
| Immunogen | RAB40 C antibody was raised using the N terminal of RAB40 corresponding to a region with amino acids QDGAAESPYAYSNGIDYKTTTILLDGRRVRLELWDTSGQGRFCTIFRSYS |
|---|
| Other Names | RAB40C|cb453|wu:fk50d06|zgc:136966|RARL|RASL8C|RAR3 |
|---|
| Gene, Accession # | Gene ID: 57799 |
|---|
| Catalog # | ABIN632024 |
|---|
| Price | |
|---|
| Order / More Info | RAB40C, Member RAS Oncogene Family (RAB40C) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|