| 产品详情 |
| Edit |   |
| Antigenic Specificity | PTPRC |
| Clone | CBXC-1868 |
| Host Species | Recombinant Mouse |
| Reactive Species | human |
| Isotype | IgG1 |
| Format | unconjugated |
| Size | n/a |
| Concentration | n/a |
| Applications | WB, IHC, IHC-P |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mouse Anti-PTPRC Recombinant Antibody (CBXC-1868). This product is a mouse antibody that recognizes PTPRC. The antibody CBXC-1868 can be used for immunoassay techniques such as: WB, IHC, IHC-P. The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitosis, and oncogenic transformation. Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. Diseases associated with PTPRC include Severe Combined Immunodeficiency, T Cell-Negative, B-Cell/Natural Killer-Cell Positi |
| Immunogen | Recombinant protein corresponding to amino acids: KLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT |
| Other Names | B220; CD45; CD45R; GP180; L-CA; LCA; LY5; T200 |
| Gene, Accession # | Gene ID: 5788, UniProt: P08575 |
| Catalog # | CBMAB-C3300-CQ |
| Price | |
| Order / More Info | PTPRC Antibody from CREATIVE BIOLABS |
| Product Specific References | n/a |
| 产品资料 |
|
|