| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RBM3 |
|---|
| Clone | CL0296 |
|---|
| Host Species | Recombinant Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | unconjugated |
|---|
| Size | n/a |
|---|
| Concentration | n/a |
|---|
| Applications | WB, IHC, IF, IHC-P |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Mouse Anti-RBM3 Recombinant Antibody (CL0296). This product is a Mouse antibody that recognizes RBM3. The antibody CL0296 can be used for immunoassay techniques such as: WB, IHC, IF, IHC-P. This gene is a member of the glycine-rich RNA-binding protein family and encodes a protein with one RNA recognition motif (RRM) domain. Expression of this gene is induced by cold shock and low oxygen tension. A pseudogene exists on chromosome 1. Multiple alternatively spliced transcript variants that are predicted to encode different isoforms have been characterized although some of these variants fit nonsense-mediated decay (NMD) criteria. [provided by RefSeq, Jul 2008] |
|---|
| Immunogen | A recombinant protein corresponding to amino acids: DEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNY |
|---|
| Other Names | RNA Binding Motif Protein 3; RNPL; RNA Binding Motif (RNP1, RRM) Protein 3; RNA-Binding Motif Protein 3; RNA-Binding Protein 3; IS1-RNPL; |
|---|
| Gene, Accession # | Gene ID: 5935, UniProt: P98179 |
|---|
| Catalog # | CBMAB-R1733-CN |
|---|
| Price | |
|---|
| Order / More Info | RBM3 Antibody from CREATIVE BIOLABS |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|