产品详情 |
Edit |   |
Antigenic Specificity | RBM3 |
Clone | CL0296 |
Host Species | Recombinant Mouse |
Reactive Species | human |
Isotype | IgG1 |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB, IHC, IF, IHC-P |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse Anti-RBM3 Recombinant Antibody (CL0296). This product is a Mouse antibody that recognizes RBM3. The antibody CL0296 can be used for immunoassay techniques such as: WB, IHC, IF, IHC-P. This gene is a member of the glycine-rich RNA-binding protein family and encodes a protein with one RNA recognition motif (RRM) domain. Expression of this gene is induced by cold shock and low oxygen tension. A pseudogene exists on chromosome 1. Multiple alternatively spliced transcript variants that are predicted to encode different isoforms have been characterized although some of these variants fit nonsense-mediated decay (NMD) criteria. [provided by RefSeq, Jul 2008] |
Immunogen | A recombinant protein corresponding to amino acids: DEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNY |
Other Names | RNA Binding Motif Protein 3; RNPL; RNA Binding Motif (RNP1, RRM) Protein 3; RNA-Binding Motif Protein 3; RNA-Binding Protein 3; IS1-RNPL; |
Gene, Accession # | Gene ID: 5935, UniProt: P98179 |
Catalog # | CBMAB-R1733-CN |
Price | |
Order / More Info | RBM3 Antibody from CREATIVE BIOLABS |
Product Specific References | n/a |
产品资料 |
|
|