| Edit |   |
|---|
| Antigenic Specificity | Required For Meiotic Nuclear Division 1 Homolog (S. Cerevisiae) (RMND1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of RMND1 protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | RMND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLNSELDLDDAIL |
|---|
| Other Names | zgc:113022|DKFZp469I1433|C6orf96|COXPD11|RMD1|bA351K16|bA351K16.3|0610042C05Rik|AA408137|AI462664|AW536662|Iag-1|RGD1309546 |
|---|
| Gene, Accession # | Gene ID: 55005,66084,292268 |
|---|
| Catalog # | ABIN632930 |
|---|
| Price | |
|---|
| Order / More Info | Required For Meiotic Nuclear Division 1 Homolog (S. Cerevisiae) (RMND1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|