| Edit |   |
|---|
| Antigenic Specificity | Nucleobindin 1 (NUCB1) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Nucleobindin, also known as calnuc, participates in Ca2+ storage in the Golgi, as well as in other biological processes that involve DNA-binding and protein-protein interactions. |
|---|
| Immunogen | Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL |
|---|
| Other Names | nuc|MGC69294|MGC81496|NUCB1|zgc:153192|DKFZp459O1814|B230337F23Rik|C77483|Calnuc|MTEST82|Nucb|CALNUC|NUC |
|---|
| Gene, Accession # | Gene ID: 4924 |
|---|
| Catalog # | ABIN633980 |
|---|
| Price | |
|---|
| Order / More Info | Nucleobindin 1 (NUCB1) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|