| Edit |   |
|---|
| Antigenic Specificity | Nucleobindin 2 (NUCB2) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Nucleobindin-2 is a calcium-binding EF-hand protein. |
|---|
| Immunogen | Nucleobindin 2 antibody was raised using the middle region of NUCB2 corresponding to a region with amino acids MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE |
|---|
| Other Names | nefa|MGC97715|NUCB2|nucleobindin-2|NEFA|AI607786|Calnuc|Nefa|Nesfatin-1|p54 |
|---|
| Gene, Accession # | Gene ID: 4925 |
|---|
| Catalog # | ABIN630150 |
|---|
| Price | |
|---|
| Order / More Info | Nucleobindin 2 (NUCB2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|