| Edit |   |
| Antigenic Specificity | Hck |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Hck Antibody from Novus Biologicals is a rabbit polyclonal antibody to Hck. This antibody reacts with human. The Hck Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Hck antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: STFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEK |
| Other Names | EC 2.7.10, EC 2.7.10.2, hemopoietic cell kinaseJTK9, p59-HCK/p60-HCK, tyrosine-protein kinase HCK |
| Gene, Accession # | HCK, Gene ID: 3055 |
| Catalog # | NBP2-57211 |
| Price | |
| Order / More Info | Hck Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |