| Edit |   |
|---|
| Antigenic Specificity | CIPAR-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CIPAR-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CIPAR-1. This antibody reacts with human. The CIPAR-1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CIPAR-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTASAPTSLLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGT |
|---|
| Other Names | Castration-induced prostatic apoptosis-related protein 1, CIPAR-1, Prostatic androgen-repressed message 1 protein, Protein PARM-1 [Precursor] |
|---|
| Gene, Accession # | PARM1, Gene ID: 25849, Accession: Q6UWI2, SwissProt: Q6UWI2 |
|---|
| Catalog # | NBP1-85610 |
|---|
| Price | |
|---|
| Order / More Info | CIPAR-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261 |
|---|