| Edit |   |
|---|
| Antigenic Specificity | InaD-Like (Drosophila) (INADL) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | INADL is a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors. |
|---|
| Immunogen | INADL antibody was raised using a synthetic peptide corresponding to a region with amino acids EVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSG |
|---|
| Other Names | wu:fc76h08|si:dz129i22.4|si:busm1-129i22.4|Cipp|InaD-like|PATJ|hINADL|Patj|Inadl2|RGD1565362 |
|---|
| Gene, Accession # | Gene ID: 10207 |
|---|
| Catalog # | ABIN634346 |
|---|
| Price | |
|---|
| Order / More Info | InaD-Like (Drosophila) (INADL) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|