| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDC80 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDC80 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDC80. This antibody reacts with human. The NDC80 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human NDC80 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQ |
|---|
| Other Names | HEC1KNTC2, HECRetinoblastoma-associated protein HEC, Highly expressed in cancer protein, highly expressed in cancer, rich in leucine heptad repeats, highly expressed in cancer, rich in leucine heptad repeats (yeast), hsHec1, hsNDC80, kinetochore associated 2, Kinetochore protein Hec1, kinetochore protein NDC80 homolog, Kinetochore-associated protein 2, NDC80 homolog, kinetochore complex component (S. cerevisiae), TID3 |
|---|
| Gene, Accession # | NDC80, Gene ID: 10403 |
|---|
| Catalog # | NBP2-56920 |
|---|
| Price | |
|---|
| Order / More Info | NDC80 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|