| Edit |   |
| Antigenic Specificity | AMHR2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat (predicted: bovine) |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband™ antibody for Anti-Muellerian hormone type-2 receptor(AMHR2) detection. Tested with WB in Human;Rat. No cross reactivity with other proteins. AMHR2 is the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human AMHR2 (384-419aa QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE), different from the related mouse and rat sequences by three amino acids. |
| Other Names | Anti-Muellerian hormone type-2 receptor;2.7.11.30;Anti-Muellerian hormone type II receptor;AMH type II receptor;MIS type II receptor;MISRII;MRII;AMHR2;AMHR, MISR2; |
| Gene, Accession # | AMHR2, UniProt: Q16671 |
| Catalog # | PB9984 |
| Price | |
| Order / More Info | AMHR2 Antibody from BOSTER BIO |
| Product Specific References | n/a |