| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PDCD10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PDCD10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDCD10. This antibody reacts with human. The PDCD10 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PDCD10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMK |
|---|
| Other Names | apoptosis-related protein 15, cerebral cavernous malformations 3, MGC1212, MGC24477, programmed cell death 10, programmed cell death protein 10, TF-1 cell apoptosis-related protein 15, TFAR15CCM3Cerebral cavernous malformations 3 protein |
|---|
| Gene, Accession # | PDCD10, Gene ID: 11235 |
|---|
| Catalog # | NBP1-86574 |
|---|
| Price | |
|---|
| Order / More Info | PDCD10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|