| Edit |   |
|---|
| Antigenic Specificity | Glycine N-Acyltransferase (GLYAT) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoA's. |
|---|
| Immunogen | GLYAT antibody was raised using the N terminal of GLYAT corresponding to a region with amino acids HYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAA |
|---|
| Other Names | ACGNAT|CAT|GAT|A330009E03Rik|AI195249|AI315345 |
|---|
| Gene, Accession # | Gene ID: 10249 |
|---|
| Catalog # | ABIN631040 |
|---|
| Price | |
|---|
| Order / More Info | Glycine N-Acyltransferase (GLYAT) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|