| Edit |   |
|---|
| Antigenic Specificity | Glycerol Kinase (GK) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GkDa). Alternatively spliced transcript variants encoding different isoforms have been identified. |
|---|
| Immunogen | GK antibody was raised using the middle region of GK corresponding to a region with amino acids MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS |
|---|
| Other Names | CG18374|Dmel\\CG18374|dGyk|gk1|gk2|gkd|gyk|GK|Gk|BmGK|DKFZp469P1225|GK1|GKD|D930012N15Rik|ASTP|Gyk |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | ABIN633106 |
|---|
| Price | |
|---|
| Order / More Info | Glycerol Kinase (GK) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|