| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Glycerol 3 Phosphate Dehydrogenase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 24549054). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glycerol 3 Phosphate Dehydrogenase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glycerol 3 Phosphate Dehydrogenase. This antibody reacts with human, mouse, rat. The Glycerol 3 Phosphate Dehydrogenase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat Glycerol 3 Phosphate Dehydrogenase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIK |
|---|
| Other Names | EC 1.1.1, EC 1.1.1.8, FLJ26652, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic, glycerol-3-phosphate dehydrogenase 1 (soluble), glycerol-3-phosphate dehydrogenase, soluble, GPD-C, GPDH-C |
|---|
| Gene, Accession # | GPD1, Gene ID: 2819 |
|---|
| Catalog # | NBP1-87411 |
|---|
| Price | |
|---|
| Order / More Info | Glycerol 3 Phosphate Dehydrogenase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24549054 |
|---|
| 产品资料 |
|
|