| Edit |   |
|---|
| Antigenic Specificity | Glycerol-3-Phosphate Dehydrogenase 1-Like (GPD1L) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS). |
|---|
| Immunogen | GPD1 L antibody was raised using the middle region of GPD1 corresponding to a region with amino acids ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV |
|---|
| Other Names | wu:fi13g03|wu:fi45b08|zgc:92580|GPD1-L|2210409H23Rik|D9Ertd660e|RGD1560123 |
|---|
| Gene, Accession # | Gene ID: 23171,333433,363159 |
|---|
| Catalog # | ABIN631705 |
|---|
| Price | |
|---|
| Order / More Info | Glycerol-3-Phosphate Dehydrogenase 1-Like (GPD1L) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|