| Edit |   |
|---|
| Antigenic Specificity | PTTG2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PTTG2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PTTG2. This antibody reacts with human. The PTTG2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human PTTG2The immunogen for this antibody is PTTG2. Peptide sequence DAPSALPKATRKALGTVNRATEKSVKTNGPRKQKQPSFSAKKMTEKTVKT. |
|---|
| Other Names | pituitary tumor-transforming 2, Pituitary tumor-transforming gene 2 protein, securin-2 |
|---|
| Gene, Accession # | PTTG2, Gene ID: 10744, Accession: NP_006598, SwissProt: NP_006598 |
|---|
| Catalog # | NBP1-79377 |
|---|
| Price | |
|---|
| Order / More Info | PTTG2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|