| Edit |   |
|---|
| Antigenic Specificity | SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane. |
|---|
| Immunogen | SCO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL |
|---|
| Other Names | Bs|CD117|Fdc|Gsfsco1|Gsfsco5|Gsfsow3|SCO1|SCO5|SOW3|Ssm|Tr-kit|W|c-KIT|SCOD1|RGD1559538 |
|---|
| Gene, Accession # | Gene ID: 6341,16590,497930 |
|---|
| Catalog # | ABIN630894 |
|---|
| Price | |
|---|
| Order / More Info | SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|