| Edit |   |
|---|
| Antigenic Specificity | Oxysterol Binding Protein-Like 3 (OSBPL3) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Several transcript variants encoding different isoforms have been identified. |
|---|
| Immunogen | OSBPL3 antibody was raised using the N terminal of OSBPL3 corresponding to a region with amino acids MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE |
|---|
| Other Names | osbpl3|zgc:101089|OSBPL3|ORP-3|ORP3|OSBP3|1200014M06Rik|6720421I08Rik|A530055M08|RGD1564287 |
|---|
| Gene, Accession # | Gene ID: 26031,71720,362360 |
|---|
| Catalog # | ABIN631463 |
|---|
| Price | |
|---|
| Order / More Info | Oxysterol Binding Protein-Like 3 (OSBPL3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|