| Edit |   |
|---|
| Antigenic Specificity | RER1 Retention in Endoplasmic Reticulum 1 Homolog (S. Cerevisiae) (RER1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RER1 is involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment. |
|---|
| Immunogen | RER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF |
|---|
| Other Names | RER1|DKFZp459K116|rer1|zgc:65968|1110060F11Rik|5830454N22Rik|AU043380|RGD1306324 |
|---|
| Gene, Accession # | Gene ID: 11079,67830,298675 |
|---|
| Catalog # | ABIN635434 |
|---|
| Price | |
|---|
| Order / More Info | RER1 Retention in Endoplasmic Reticulum 1 Homolog (S. Cerevisiae) (RER1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|