| Edit |   |
| Antigenic Specificity | Resistance To Inhibitors of Cholinesterase 8 Homolog A (C. Elegans) (RIC8A) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | RIC8A is a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins.RIC8A is able to activate GNAI1, GNAO1 and GNAQ, but not GNAS by exchanging bound GDP for free GTP.RIC8A is involved in regulation of microtubule pulling forces during mitotic movement of chromosomes by stimulating G(i)-alpha protein, possibly leading to release G(i)-alpha-GTP and NuMA proteins from the NuMA-GPSM2-G(i)-alpha-GDP complex. RIC8A also acts as an activator for G(q)-alpha (GNAQ) protein by enhancing the G(q)-coupled receptor-mediated ERK activation. |
| Immunogen | RIC8 A antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKGVRLL |
| Other Names | CG15797|DmRic8|Dmel\\CG15797|RIC-8|Ric-8|l(1)G0397|ric-8|ric-8a|ric8|synembryn|xtric-8|zgc:92294|ric8a|ricc8aa|AI114950|Ric8a|Ric-8A|Ric8|RIC8|Syn|ric8ab |
| Gene, Accession # | Gene ID: 60626 |
| Catalog # | ABIN633084 |
| Price | |
| Order / More Info | Resistance To Inhibitors of Cholinesterase 8 Homolog A (C. Elegans) (RIC8A) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |