| Edit |   |
|---|
| Antigenic Specificity | Resistance To Inhibitors of Cholinesterase 8 Homolog B (C. Elegans) (RIC8B) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RIC8B is a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP (By similarity). Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction. |
|---|
| Immunogen | RIC8 B antibody was raised using a synthetic peptide corresponding to a region with amino acids HQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPL |
|---|
| Other Names | DKFZp469H2225|BC051080|Ric-8|Ric-8b|RIC8|hSyn |
|---|
| Gene, Accession # | Gene ID: 55188,237422,314681 |
|---|
| Catalog # | ABIN632939 |
|---|
| Price | |
|---|
| Order / More Info | Resistance To Inhibitors of Cholinesterase 8 Homolog B (C. Elegans) (RIC8B) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|