| 产品详情 |
| Edit |   |
| Antigenic Specificity | Exportin-5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Exportin-5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Exportin-5. This antibody reacts with human, mouse, rat. The Exportin-5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat Exportin-5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ASLVHLAFQIYEALRPRYLEIRAVMEQIPEIQKDSLDQFDCKLLNPSLQKVADKRRKDQFKRLIAGCIGKPLGEQFRKEVH |
| Other Names | Exp5, exportin 5, exportin-5, FLJ14239, FLJ32057, FLJ45606, KIAA1291exp5, Ran-binding protein 21, RANBP21 |
| Gene, Accession # | XPO5, Gene ID: 57510 |
| Catalog # | NBP1-89605 |
| Price | |
| Order / More Info | Exportin-5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|