| Edit |   |
| Antigenic Specificity | Sec23 Homolog B (S. Cerevisiae) (SEC23B) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SEC23B is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. SEC23B has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function SEC23B has been implicated in cargo selection and concentration. |
| Immunogen | SEC23 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPI |
| Other Names | CDA-II|CDAII|CDAN2|HEMPAS|wu:fd19h01|wu:fl08h02|zgc:55595|zgc:86871|SEC23A |
| Gene, Accession # | Gene ID: 10483,27054,362226 |
| Catalog # | ABIN631828 |
| Price | |
| Order / More Info | Sec23 Homolog B (S. Cerevisiae) (SEC23B) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |