| Edit |   |
|---|
| Antigenic Specificity | SEC63 Homolog (S. Cerevisiae) (SEC63) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. SEC63 and SEC62 protein are found to be associated with ribosome-free SEC61 complex. |
|---|
| Immunogen | SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA |
|---|
| Other Names | DNAJC23|ERdj2|PRO2507|SEC63L|SEC63-like|zgc:92718|5730478J10Rik|AI649014|AW319215 |
|---|
| Gene, Accession # | Gene ID: 11231,140740,309858 |
|---|
| Catalog # | ABIN635435 |
|---|
| Price | |
|---|
| Order / More Info | SEC63 Homolog (S. Cerevisiae) (SEC63) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|