| Edit |   |
|---|
| Antigenic Specificity | CISH/CIS-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CISH/CIS-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CISH/CIS-1. This antibody reacts with mouse. The CISH/CIS-1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human CishThe immunogen for this antibody is Cish. Peptide sequence RESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPT. |
|---|
| Other Names | CIS-1cytokine-inducible SH2-containing protein, CIScytokine-inducible inhibitor of signaling type 1B, cytokine inducible SH2-containing protein, G18Protein G18, SOCS, Suppressor of cytokine signaling |
|---|
| Gene, Accession # | CISH, Gene ID: 1154, Accession: NP_034025 |
|---|
| Catalog # | NBP1-79513-20ul |
|---|
| Price | |
|---|
| Order / More Info | CISH/CIS-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|