| Edit |   |
| Antigenic Specificity | Endoplasmic Reticulum Protein 29 (ERP29) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Immunogen | ERP29 antibody was raised using the N terminal of ERP29 corresponding to a region with amino acids MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI |
| Other Names | C12orf8|ERp28|ERp31|PDI-DB|PDIA9|1200015M03Rik|2810446M09Rik|AW209030|Erp28|Erp31|PDI-Db |
| Gene, Accession # | Gene ID: 10961 |
| Catalog # | ABIN635286 |
| Price | |
| Order / More Info | Endoplasmic Reticulum Protein 29 (ERP29) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |