| Edit |   |
|---|
| Antigenic Specificity | Family with Sequence Similarity 36, Member A (FAM36A) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | FAM36A is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of FAM36A remains unknown. |
|---|
| Immunogen | FAM36 A antibody was raised using the middle region of FAM36 corresponding to a region with amino acids LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN |
|---|
| Other Names | 2310005N03Rik|Fam36a|FAM36A |
|---|
| Gene, Accession # | Gene ID: 116228 |
|---|
| Catalog # | ABIN632967 |
|---|
| Price | |
|---|
| Order / More Info | Family with Sequence Similarity 36, Member A (FAM36A) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|