| Edit |   |
|---|
| Antigenic Specificity | Family with Sequence Similarity 54, Member A (FAM54A) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | FAM54A belongs to the MTFR1/FAM54 family. The function of the FAM54A protein is not known. |
|---|
| Immunogen | FAM54 A antibody was raised using the middle region of FAM54 corresponding to a region with amino acids NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ |
|---|
| Other Names | FAM54A|DUFD1|2610016C23Rik|4933412C16Rik|Dufd1|Fam54a |
|---|
| Gene, Accession # | Gene ID: 113115 |
|---|
| Catalog # | ABIN632084 |
|---|
| Price | |
|---|
| Order / More Info | Family with Sequence Similarity 54, Member A (FAM54A) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|