| Edit |   |
|---|
| Antigenic Specificity | Family with Sequence Similarity 82, Member A1 (FAM82A1) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | FAM82A belongs to the FAM82/RMD family. It is a single-pass membrane protein. The function of the FAM82A protein remains unknown. |
|---|
| Immunogen | FAM82 A antibody was raised using the middle region of Fam82 corresponding to a region with amino acids WRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHLWYAV |
|---|
| Other Names | rmd2|rmd-2|fam82a|block18|MGC145512|FAM82A|FAM82A1|PRO34163|PYST9371|RMD-2|RMD2|RMD4|Fam82a|Fam82a1|AW061290|mRMD-2 |
|---|
| Gene, Accession # | Gene ID: 151393 |
|---|
| Catalog # | ABIN631940 |
|---|
| Price | |
|---|
| Order / More Info | Family with Sequence Similarity 82, Member A1 (FAM82A1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|